LL-37 5mg

LL-37 5mg - High-Quality Research Peptide

LL-37, offered at 5mg, is a high-quality specialised research peptide developed for advanced scientific exploration in immunology and microbiology. This product is ideal for laboratory settings where precision and reliability are paramount.

• Product Name: LL-37 5mg
• Catalogue Number: LL37-5mg
• Molecular Formula: C205H340N60O53
• Molecular Weight: 4493.3 g/mol
• Purity: ≥98%
• Sequence: [LL-37, 37 aa]
• Form: Lyophilised Solid

Storage and Handling:

LL-37 is supplied as a lyophilised solid to ensure maximum stability and ease of use in research environments. Store the sealed vial at -20°C, protected from light and moisture. All handling and laboratory procedures are determined by the receiving laboratory under its own protocols.

Synthesis and Quality Assurance:

LL-37 is meticulously synthesised through a controlled process that guarantees high purity (≥98%) and stability, making it suitable for precise scientific studies. Our commitment to excellence ensures that each batch undergoes stringent quality control to meet the rigorous standards researchers require.

Legal and Safety Information:

UK-Peptides proudly provides LL-37 strictly for scientific and research use. In alignment with our dedication to supporting the research community, we ensure our products meet stringent quality standards and legal requirements. Please note that our peptides, including LL-37, are not designed for human consumption or clinical application.

If you require high-quality LL-37 for your research in the UK, explore our range of peptides designed for scientific rigour and innovation.

Why Choose UK Peptides for LL-37 5mg in the UK?

UK Peptides has supplied research-grade peptides to the UK scientific community since 2012. We work directly with our manufacturing partner rather than through third-party resellers, so every batch of LL-37 5mg is tested before it reaches your freezer, and consistency carries from one order to the next. Orders placed before 3pm are dispatched the same day, with tracked next-day delivery available across the UK.

Reconstitution in a Research Setting:

As a lyophilised peptide, LL-37 5mg is typically reconstituted immediately before use by adding sterile or bacteriostatic water directly to the vial, rather than by vigorous mixing, to protect the peptide's structure. The exact diluent, volume, and resulting concentration are decisions for the receiving laboratory's own protocols and intended assay. Once reconstituted, peptides are generally less stable than in lyophilised form and are best used promptly or kept refrigerated for short-term storage only, again under the receiving laboratory's own procedures.

Frequently Asked Questions

Is LL-37 5mg intended for human use?
No. It is sold strictly for in-vitro laboratory research and is not a medicine, supplement, or food product.

What form does LL-37 5mg ship in?
As a sealed, lyophilised (freeze-dried) vial, the standard form for stable storage and transport of research peptides.

What purity standard does this batch meet?
See the specification list above for this product's confirmed purity and batch details.

Quality Control at Every Batch:

Every batch of LL-37 5mg that reaches our freezer has already been through our manufacturing partner's own analytical verification before dispatch, checking identity and purity against the specification shown above. Peptides are inherently sensitive to heat, light, and moisture, so batches are kept in temperature-controlled storage from the point they arrive with us until they are picked, packed, and dispatched — the same cold-chain discipline we ask researchers to continue once a vial reaches their own laboratory.

Does this come with a Certificate of Analysis?
Where a Safety Data Sheet or Certificate of Analysis is available for LL-37 5mg, it can be accessed from this product page; see the Safety Data Sheet tab above if present for this item.

Explore More Research Peptides:

LL-37 5mg is one entry in our full peptide catalogue, alongside related compounds such as GHRP-6 5mg. Researchers cross-referencing compound data for their own records may also find the NCBI PubChem database, a free public compound reference maintained by the US National Library of Medicine, a useful independent source alongside the specification listed above.